| Edit |   |
| Antigenic Specificity | CHMP4B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 100%, rat 100%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC, WB. Recombinant expression validation in WB using target protein overexpression. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human CHMP4B polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKK |
| Other Names | charged multivesicular body protein 4B, C20orf178, dJ553F4.4, Shax1, SNF7-2, VPS32B |
| Gene, Accession # | Gene ID: 128866, UniProt: Q9H444, ENSG00000101421 |
| Catalog # | HPA041401 |
| Price | |
| Order / More Info | CHMP4B Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |