| Edit |   |
| Antigenic Specificity | NIMA (Never In Mitosis Gene A)-Related Kinase 11 (NEK11) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | NEK11 is a member of the never in mitosis gene A family of kinases. NEK11 localizes to the nucleoli, and may function with NEK2A in the S-phase checkpoint. It appears to play roles in DNA replication and response to genotoxic stress. NEK11 belongs to the NIMA family of kinases, which are involved in DNA replication and genotoxic stress responses. |
| Immunogen | NEK11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMS |
| Other Names | nek11|MGC147549|4932416N14Rik |
| Gene, Accession # | Gene ID: 79858 |
| Catalog # | ABIN630865 |
| Price | |
| Order / More Info | NIMA (Never In Mitosis Gene A)-Related Kinase 11 (NEK11) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |