| Edit |   |
| Antigenic Specificity | NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Aspergillus nidulans 'never in mitosis A' (NIMA) gene encodes a serine/threonine kinase that controls initiation of mitosis. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA. |
| Immunogen | NEK6 antibody was raised using a synthetic peptide corresponding to a region with amino acids FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR |
| Other Names | 1300007C09Rik|si:ch211-167p9.4|ATNEK5|MOE17.17|NIMA-RELATED KINASE5|NIMA-related kinase 5|SID6-1512 |
| Gene, Accession # | Gene ID: 10783,59126,360161 |
| Catalog # | ABIN634350 |
| Price | |
| Order / More Info | NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |