If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Anti-ABCB10 Antibody. Reactivity: Human, Rat No cross reactivity with other proteins.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ABCB10 (640-678aa QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR), different from the related mouse sequence by one amino acid.
Other Names
ATP-binding cassette sub-family B member 10, mitochondrial; ATP-binding cassette sub-family B member 10, mitochondrial; ATP-binding cassette sub-family B member 10, mitochondrial; ATP binding cassette subfamily B member 10; ATP-binding cassette transporter 10; ABC transporter 10 protein; Mitochondrial ATP-binding cassette 2; M-ABC2, ABCB10; ABCB10; M-ABC2; MTABC2; EST20237; ABC transporter 10 protein; M-ABC2
1. Allikmets, R., Gerrard, B., Glavac, D., Ravnik-Glavac, M., Jenkins, N. A., Gilbert, D. J., Copeland, N. G., Modi, W., Dean, M.Characterization and mapping of three new mammalian ATP-binding transporter genes from an EST database. Mammalian Genome 6: 114-117, 1995. 2. Chen, W., Paradkar, P. N., Li, L., Pierce, E. L., Langer, N. B., Takahashi-Makise, N., Hyde, B. B., Shirihai, O. S., Ward, D. M., Kaplan, J., Paw, B. H. Abcb10 physically interacts with mitoferrin-1 (Slc25a37) to enhance its s