| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | DARPP32 |
| Clone | n/a |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Anti-DARPP32 Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA), identical to the related mouse and rat sequences.Ig Type: Rabbit IgG |
| Other Names | protein phosphatase 1 regulatory subunit 1B isoform 2; Protein phosphatase 1 regulatory subunit 1B; protein phosphatase 1 regulatory subunit 1B; protein phosphatase 1 regulatory inhibitor subunit 1B; DARPP-32; Dopamine- and cAMP-regulated neuronal phosphoprotein, PPP1R1B; PPP1R1B; DARPP32; DARPP-32; DARPP32 |
| Gene, Accession # | DARPP32, Gene ID: 84152, NCBI: NP_001229393.1, UniProt: Q9UD71 |
| Catalog # | MBS177854 |
| Price | |
| Order / More Info | DARPP32 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: PPP1R1B protein phosphatase 1, regulatory (inhibitor) subunit 1B (dopamine and cAMP regulated phosphoprotein, DARPP-32). 2. Brene S, Lindefors N, Ehrlich M, Taubes T, Horiuchi A, Kopp J, Hall H, Sedvall G, Greengard P, Persson H (March 1994). Expression of mRNAs encoding ARPP-16/19, ARPP-21, and DARPP-32 in human brain tissue. J. Neurosci. 14 (3 Pt 1): 985-98. 3. Ouimet CC, Greengard P (February 1990). Distribution of DARPP-32 in the basal ganglia: an electron microscopic st |
| 產(chǎn)品資料 |
|
|