If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
n/a
Immunogen
Fusion protein amino acids 111-254 (cytoplasmic C-terminus) of mouse REEP2 (also known as Receptor expression-enhancing protein 2, C5orf19, SGC32445 and LOC682105, accession number Q8VCD6) Rat: 97% identity (140/144 amino acids identical) Human: 86% identity (125/144 amino acids identical) <40% identity with REEP1 and REEP4 but >65% identity for first 46 amino acids (RDKSYETMMRVGKRGLNLAANAAVTAAAKGQGVLSEKLRSFSMQDL)
Other Names
Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein) Receptor expression-enhancing protein 2