If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
n/a
Immunogen
Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 (also known as Glutamate receptor 2, AMPA-selective glutamate receptor 2, Glutamate receptor ionotropic AMPA 2, GluR-B, GluR-K2 and Gria2, accession number P19491); Mouse: 98% identity (49/50 amino acids identical); Human: 98% identity (49/50 amino acids identical); 100% identity between Flip and Flop isoforms; 70% identity with GluA3/GluR3 and less identity with GluA1/GluR1 and GluA4/GluR4