If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
n/a
Immunogen
Fusion protein amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP (also known as Synaptic vesicle 2-related protein and SV2-related protein, accession number Q9Z2I7)Mouse: 97% identity (83/85 amino acids identical)Human: 95% identity (81/85 amino acids identical)<20% overall identity with SVOPL/SVOP2 but >80% identity (14/16 amino acids) near C-terminus(TFMVEDAVEAIGFGRF)
Other Names
Synaptic vesicle 2-related protein (SV2-related protein)