If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
n/a
Immunogen
Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B (also known as Sulfonylurea receptor 2B, ATP-binding cassette transporter subfamily C member 9B and Abcc9B, accession number Q63563-2); Mouse: 100% identity (43/43 amino acids identical); Human: 97% identity (42/43 amino acids identical); 75% identity with SUR1
Other Names
ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1) ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)