| Edit |   |
|---|
| Antigenic Specificity | ERF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ERF Antibody from Novus Biologicals is a rabbit polyclonal antibody to ERF. This antibody reacts with human. The ERF Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ERF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KPEPGEAPGASQCMPLKLRFKRRWSEDCRLEGGGGPAGGFEDEGEDKKVRG |
|---|
| Other Names | Ets2 repressor factorPE-2PE2ETS domain-containing transcription factor ERF |
|---|
| Gene, Accession # | ERF, Gene ID: 2077 |
|---|
| Catalog # | NBP2-56079 |
|---|
| Price | |
|---|
| Order / More Info | ERF Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|