Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against recombinant protein for WB. It has been used for IF and ELISA.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The CKS2 Antibody (2H5-2C4) from Novus Biologicals is a mouse monoclonal antibody to CKS2. This antibody reacts with human. The CKS2 Antibody (2H5-2C4) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence.
Immunogen
CKS2 (AAH06458, 1 a.a. - 79 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK