| Edit |   |
|---|
| Antigenic Specificity | ZSCAN5D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZSCAN5D Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZSCAN5D. This antibody reacts with human. The ZSCAN5D Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human LOC646698. Peptide sequence RKNLNEHKLIHSGEKPYKCPKCLRAFRRPETLKYHQKTHQETTAPRECEG. |
|---|
| Other Names | Putative zinc finger and SCAN domain-containing protein 5D, zinc finger and SCAN domain containing 5D, ZNF495D |
|---|
| Gene, Accession # | ZSCAN5D, Gene ID: 646698 |
|---|
| Catalog # | NBP1-91322 |
|---|
| Price | |
|---|
| Order / More Info | ZSCAN5D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|