| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | ZSCAN21/ZFP38 |
| Clone | 4F10 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZSCAN21/ZFP38 Antibody (4F10) from Novus Biologicals is a mouse monoclonal antibody to ZSCAN21/ZFP38. This antibody reacts with human. The ZSCAN21/ZFP38 Antibody (4F10) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | ZSCAN21 (NP_666019, 136 a.a. - 224 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDI |
| Other Names | DKFZp434L134, KOX25, NY-REN-21, Renal carcinoma antigen NY-REN-21, Zfp-38, ZFP38, zinc finger and SCAN domain containing 21, zinc finger and SCAN domain-containing protein 21, zinc finger protein 38, zinc finger protein 38 (KOX 25), Zinc finger protein 38 homolog, zinc finger protein NY-REN-21 antigen, Zipro1, ZNF38DKFZp686H10254 |
| Gene, Accession # | ZSCAN21, Gene ID: 7589, Accession: NP_666019, SwissProt: NP_666019 |
| Catalog # | H00007589-M16 |
| Price | |
| Order / More Info | ZSCAN21/ZFP38 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|