If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Rabbit IgG polyclonal Picoband? antibody for ASXL1 detection. Tested with WB, FCM in Human;Mouse;Rat. No cross reactivity with other proteins. Putative Polycomb group protein ASXL1 is a protein that in humans is encoded by the ASXL1 gene. This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants.
Immunogen
A synthetic peptide corresponding to a sequence of human ASXL1 (KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE).
Other Names
Putative Polycomb group protein ASXL1; Additional sex combs-like protein 1; ASXL1; KIAA0978