| Edit |   |
| Antigenic Specificity | Eukaryotic Translation Initiation Factor 4 Gamma, 1 (EIF4G1) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | EIF4G1 is a component of the protein complex EIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure, and recruitment of mRNA to the ribosome. |
| Immunogen | EIF4 G1 antibody was raised using the middle region of EIF4 1 corresponding to a region with amino acids PAVPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQ |
| Other Names | EIF4GI|CG10811|Dmel\\CG10811|EIF4G|Eif4G|deIF4G|eIF-4G|eIF4g|p200|EIF4G1|wu:fb50a05|wu:fc60b06|eif4g|CUCUMOVIRUS MULTIPLICATION 2|CUM2|EUKARYOTIC TRANSLATION INITIATION FACTOR 4G|eukaryotic translation initiation factor 4G|DDBDRAFT_0217646|DDBDRAFT_0217647|DDBDRAFT_0234257|DDB_0217646|DDB_0217647|DDB_0234257|NV18824|EIF-4G1|EIF4F|P220|PARK18|p220|E030015G23Rik|eIF4GI |
| Gene, Accession # | Gene ID: 1981 |
| Catalog # | ABIN633448 |
| Price | |
| Order / More Info | Eukaryotic Translation Initiation Factor 4 Gamma, 1 (EIF4G1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |