Purity ~98% (SDS-PAGE, HPLC). Homodimeric interleukin-17F is a member of the IL-17 family of six homodimeric proteins (IL-17A-17F). Activated CD4+ T cells have also been shown to produce Mouse IL-17F. Activity studies reveal IL-17A to be the most potent, followed by IL-17A/F and IL-17F 100 fold lower than IL-17A. Recombinant Mouse IL-17F produced in E. coli is a non-glycosylated polypeptide comprised of two monomeric subunit each of mIL-17F. The dimer consists of 266aa, with an approximate molecular weight of 29.8kD Source: Recombinant coreesponding to mouse IL-17F expressed in E. coli. AA Sequence: RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDP HRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKV GCTCVKPIVHQAA Molecular Weight: ~29.8kD Endotoxin Level: <0.01ng/ug Biological Activity: IL-17F is fully bioactive when compared to standard. The ED50 as determined by the dose-dependent induction of IL-6 in NHDF is 1.94ng/ml.