Highly Purified (~90%). The protein encoded by this gene is an inducible molecular chaperone that functions as a homodimer. The encoded protein aids in the proper folding of specific target proteins by use of an ATPase activity that is modulated by co-chaperones. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]. Source: Recombinant protein corresponding to aa535-732 from human Heat Shock Protein 90 alpha, fused to His-tag and Avi-tag at N-terminal, expressed in E. coli. Molecular Weight: ~25kD AA Sequence: MHHHHHHGGGLNDIFEAQKIEWHEEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTK FENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTM GYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTH ANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD Applications: Suitable for use in the study of enzyme kinetics, screening inhibitors, and selectivity profiling.