If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The N4BP2L2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to N4BP2L2. This antibody reacts with human. The N4BP2L2 Antibody has been validated for the following applications: Western Blot.
Immunogen
Synthetic peptides corresponding to RP11-298P3.3 (NEDD4 binding protein 2-like 2) The peptide sequence was selected from the N terminal of RP11-298P3.3)(50ug). Peptide sequence EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN.
Other Names
CG005FLJ41089, CG016, FLJ36195, NEDD4 binding protein 2-like 2, NEDD4-binding protein 2-like 2, PFAAP5FLJ43077, Phosphonoformate immuno-associated protein 5,92M18.3,92M18.3 (novel protein), protein from BCRA2 region