| Edit |   |
|---|
| Antigenic Specificity | SCAND2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SCAND2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SCAND2. This antibody reacts with human. The SCAND2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human SCAND2The immunogen for this antibody is SCAND2. Peptide sequence IQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL. |
|---|
| Other Names | SCAN domain containing 2 pseudogene |
|---|
| Gene, Accession # | SCAND2, Gene ID: 54581 |
|---|
| Catalog # | NBP1-79710-20ul |
|---|
| Price | |
|---|
| Order / More Info | SCAND2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|