| Edit |   |
| Antigenic Specificity | TROVE Domain Family, Member 2 (TROVE2) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, dog |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | TROVE2 belongs to the Ro 60 kDa family. It is RNA-binding protein that binds to several small cytoplasmic RNA molecules known as Y RNAs. It may stabilize these RNAs from degradation. |
| Immunogen | TROVE2 antibody was raised using the N terminal of TROVE2 corresponding to a region with amino acids QDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGR |
| Other Names | SSA2|TROVE2|ssa2|ssa2-A|RO60|RORNP|1810007I17Rik|A530054J02Rik|AI646302|SS-A/Ro|Ssa|Ssa2 |
| Gene, Accession # | Gene ID: 6738,478957,20822 |
| Catalog # | ABIN633333 |
| Price | |
| Order / More Info | TROVE Domain Family, Member 2 (TROVE2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |