| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | Ribosomal Protein L17 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Ribosomal Protein L17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ribosomal Protein L17. This antibody reacts with human. The Ribosomal Protein L17 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Ribosomal Protein L17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KNTRETAQAIKGMHIRKATKYLKDVTLQKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKM |
| Other Names | FLJ18762,60S ribosomal protein L23, FLJ92089, gene encoding putative NFkB activating protein, MGC117162, PD-1, ribosomal protein L17, rpL23, RPL23,60S ribosomal protein L17 |
| Gene, Accession # | RPL17, Gene ID: 6139 |
| Catalog # | NBP2-48798 |
| Price | |
| Order / More Info | Ribosomal Protein L17 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|