| Edit |   |
| Antigenic Specificity | Hepatitis A Virus Cellular Receptor 2 (HAVCR2) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | hepatitis a virus (hav) |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | HAVCR2 regulates macrophage activation. HAVCR2 inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. HAVCR2 may be also involved in T-cell homing. |
| Immunogen | HAVCR2 antibody was raised using the N terminal of HAVCR2 corresponding to a region with amino acids MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP |
| Other Names | HAVCR2|MGC140131|HAVcr-2|KIM-3|TIM3|TIMD-3|TIMD3|Tim-3|TIM-3|Tim3|Timd3|tim3 |
| Gene, Accession # | n/a |
| Catalog # | ABIN635817 |
| Price | |
| Order / More Info | Hepatitis A Virus Cellular Receptor 2 (HAVCR2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |