| Edit |   |
| Antigenic Specificity | Deafness, Autosomal Dominant 5 (DFNA5) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Hearing impairment is a heterogeneous condition with over 40 loci described. DFNA5 is expressed in fetal cochlea, however, its function is not known. Nonsyndromic hearing impairment is associated with a mutation in its gene. |
| Immunogen | DFNA5 antibody was raised using the C terminal of DFNA5 corresponding to a region with amino acids AALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQR |
| Other Names | Dfna5h|fk59f08|zgc:91916|wu:fc41e05|wu:fk59f08|MGC83660|ICERE-1|2310037D07Rik|4932441K13Rik|EG14210|Fin15 |
| Gene, Accession # | Gene ID: 1687 |
| Catalog # | ABIN629840 |
| Price | |
| Order / More Info | Deafness, Autosomal Dominant 5 (DFNA5) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |