| Edit |   |
| Antigenic Specificity | RAD9 Homolog B (S. Pombe) (RAD9B) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of RAD9B protein is not widely studied, and is yet to be elucidated fully. |
| Immunogen | RAD9 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEED |
| Other Names | A630082N15Rik|BC021784 |
| Gene, Accession # | Gene ID: 144715 |
| Catalog # | ABIN634195 |
| Price | |
| Order / More Info | RAD9 Homolog B (S. Pombe) (RAD9B) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |