human, mouse, rat (predicted: bovine, canine, hamster, horse, monkey, rabbit)
Isotype
n/a
Format
immunogen affinity purified
Size
100ug (sample available)
Concentration
500ug/ml.
Applications
WB
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Rabbit IgG polyclonal Picoband? antibody for Lysine-specific demethylase 5B(KDM5B) detection. Tested with WB in Human;Mouse;Rat. No cross reactivity with other proteins. Lysine-specific demethylase 5B, also known as histone demethylase JARID1B, is a demethylase enzyme that in humans is encoded by the KDM5B gene. This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing resultsi n multiple transcript variants.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human KDM5B (641-685aa DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFE LL), identical to the related mouse and rat sequences.
Other Names
Lysine-specific demethylase 5B;1.14.11.-;Cancer/testis antigen 31;CT31;Histone demethylase JARID1B;Jumonji/ARID domain-containing protein 1B;PLU-1;Retinoblastoma-binding protein 2 homolog 1;RBP2-H1;KDM5B;JARID1B, PLU1, RBBP2H1;