If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The PCTP Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCTP. This antibody reacts with human. The PCTP Antibody has been validated for the following applications: Western Blot.
Immunogen
The immunogen for this antibody is PCTP - middle region. Peptide sequence QLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWA.
Other Names
PC-TP, phosphatidylcholine transfer protein, StARD2, STARD2StAR-related lipid transfer (START) domain containing 2, StAR-related lipid transfer protein 2, START domain-containing protein 2