| Edit |   |
| Antigenic Specificity | KPNA2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband? antibody for Importin subunit alpha-1(KPNA2) detection. Tested with WB in Human. No cross reactivity with other proteins. Importin subunit alpha-2 is a protein that in humans is encoded by the KPNA2 gene. The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in V(D)J recombination. |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human KPNA2 (2-46aa STNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQ), different from the related mouse sequence by three amino acids. |
| Other Names | Importin subunit alpha-1;Karyopherin subunit alpha-2;RAG cohort protein 1;SRP1-alpha;KPNA2;RCH1, SRP1; |
| Gene, Accession # | KPNA2, UniProt: P52292 |
| Catalog # | A01776-1 |
| Price | |
| Order / More Info | KPNA2 Antibody from BOSTER BIO |
| Product Specific References | n/a |