| Edit |   |
|---|
| Antigenic Specificity | Karyopherin alpha 3 (Importin alpha 4) (KPNA3) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kDa) can pass through the nuclear pore by nonselective diffusion, larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA3 is a protein similar to certain nuclear transport proteins of Xenopus and human. |
|---|
| Immunogen | Karyopherin Alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV |
|---|
| Other Names | IPOA4|si:dz79f24.2|importin|SRP1|SRP1gamma|SRP4|hSRP1|ipoa4|srp1|srp1gamma|srp4 |
|---|
| Gene, Accession # | Gene ID: 3839,16648,361055 |
|---|
| Catalog # | ABIN630663 |
|---|
| Price | |
|---|
| Order / More Info | Karyopherin alpha 3 (Importin alpha 4) (KPNA3) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|