If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Rabbit IgG polyclonal Picoband? antibody for Bile salt sulfotransferase(SULT2A1) detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. Bile salt sulfotransferase, also known as hydroxysteroid sulfotransferase (HST) or sulfotransferase 2A1 (ST2A1), is an enzyme that in humans is encoded by the SULT2A1 gene. It is mapped to 19q13.3. This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, and may have a role in the inherited adrenal androgen excess in women with polycystic ovary syndrome.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SULT2A1 (253-285aa DWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE), different from the related mouse sequence by seven amino acids, and from the related rat sequence by eight amino acids.
Other Names
Bile salt sulfotransferase;2.8.2.14;Dehydroepiandrosterone sulfotransferase;DHEA-ST;Hydroxysteroid Sulfotransferase;HST;ST2;ST2A3;Sulfotransferase 2A1;ST2A1;SULT2A1;HST, STD;