| Edit |   |
| Antigenic Specificity | Transmembrane Protease, serine 11D (TMPRSS11D) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | TMPRSS11D is a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions. |
| Immunogen | TMPRSS11 D antibody was raised using the middle region of TMPRSS11 corresponding to a region with amino acids IHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVC |
| Other Names | 2810009A20Rik|4833427O07Rik|5830447M11Rik|AA408215|Hy5|Ncoat|mKIAA0679|O-GLCNACASE|HAT|AST|AsP|BC020151|Asp |
| Gene, Accession # | Gene ID: 9407 |
| Catalog # | ABIN635959 |
| Price | |
| Order / More Info | Transmembrane Protease, serine 11D (TMPRSS11D) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |