Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The GFER/ALR Antibody from Novus Biologicals is a rabbit polyclonal antibody to GFER/ALR. This antibody reacts with human, rat. The GFER/ALR Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, rat GFER/ALR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Other Names
ALRFAD-linked sulfhydryl oxidase ALR, Augmenter of liver regeneration, EC 1.8.3.2, ERV1 homolog, ERV1hepatopoietin protein, erv1-like growth factor, growth factor, augmenter of liver regeneration, growth factor, erv1 (S. cerevisiae)-like (augmenter of liver regeneration), Hepatopoietin, hERV1, HERV1hepatic regenerative stimulation substance, HPO, HPO1, HPO2, HSS, truncated augmenter of liver regeneration