| Edit |   |
| Antigenic Specificity | RNA Binding Motif Protein 22 (RBM22) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | RBM22 may be involved in pre-mRNA splicing. |
| Immunogen | RBM22 antibody was raised using the middle region of RBM22 corresponding to a region with amino acids HFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV |
| Other Names | fb37a01|zgc:77910|wu:fb37a01|wu:fc62e03|wu:fe05c04|RBM22|Cwc2|ZC3H16|fSAP47|8430430L24Rik|cg14641 |
| Gene, Accession # | Gene ID: 55696,66810,307410 |
| Catalog # | ABIN633354 |
| Price | |
| Order / More Info | RNA Binding Motif Protein 22 (RBM22) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |