| Edit |   |
|---|
| Antigenic Specificity | RNA Binding Motif Protein 39 (RBM39) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RBM39 is an RNA binding protein and possible splicing factor. It is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. |
|---|
| Immunogen | RBM39 antibody was raised using the middle region of RBM39 corresponding to a region with amino acids FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVRE |
|---|
| Other Names | RBM39|Rbm39|ACYPI002389|DKFZp459F148|CAPER|CAPERalpha|FSAP59|HCC1|RNPC2|rnpc2|1500012C14Rik|2310040E03Rik|B330012G18Rik|C79248|R75070|Rnpc2|caper|zgc:55780 |
|---|
| Gene, Accession # | Gene ID: 9584,170791,362251 |
|---|
| Catalog # | ABIN633242 |
|---|
| Price | |
|---|
| Order / More Info | RNA Binding Motif Protein 39 (RBM39) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|