| Edit |   |
| Antigenic Specificity | RNA Binding Motif Protein 42 (RBM42) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | RBM42 belongs to the RRM RBM42 family and it contains 1 RRM (RNA recognition motif) domain. The functions of RBM42 remain unknown. |
| Immunogen | RBM42 antibody was raised using the middle region of RBM42 corresponding to a region with amino acids RPRPPRPEPPPGLMALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPS |
| Other Names | rbm42b|MGC10433l|zgc:109907|rbm42|rbm42a|1700003D06Rik|3100004P22Rik|RGD1306184 |
| Gene, Accession # | Gene ID: 79171 |
| Catalog # | ABIN633507 |
| Price | |
| Order / More Info | RNA Binding Motif Protein 42 (RBM42) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |