| Edit |   |
| Antigenic Specificity | RNA Binding Motif Protein 9 (RBM9) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | RBM9 is a RNA-binding protein that seems to act as a coregulatory factor of ER-alpha. |
| Immunogen | RBM9 antibody was raised using the middle region of RBM9 corresponding to a region with amino acids PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT |
| Other Names | rta|fox2|xrbm9|hrnbp2|MGC79813|RBM9|rbm9a|FOX2|Fox-2|HNRBP2|HRNBP2|RTA|dJ106I20.3|fxh|2810460A15Rik|AA407676|AI118529|Fbm2|Fxh|Hrnbp2|Rbm9|rbm9|zgc:85694|fox-2|hnrbp2|rbfox2|rbm9-b|rbm9b |
| Gene, Accession # | Gene ID: 23543 |
| Catalog # | ABIN634463 |
| Price | |
| Order / More Info | RNA Binding Motif Protein 9 (RBM9) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |