| Edit |   |
|---|
| Antigenic Specificity | DAZ Associated Protein 1 (DAZAP1) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. |
|---|
| Immunogen | DAZAP1 antibody was raised using the C terminal of DAZAP1 corresponding to a region with amino acids LAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQP |
|---|
| Other Names | MGC89358|DAZAP1|2410042M16Rik|mPrrp |
|---|
| Gene, Accession # | Gene ID: 26528 |
|---|
| Catalog # | ABIN629928 |
|---|
| Price | |
|---|
| Order / More Info | DAZ Associated Protein 1 (DAZAP1) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|