| Edit |   |
| Antigenic Specificity | serglycin (SRGN) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SRGN is a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. SRGN was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. |
| Immunogen | Serglycin antibody was raised using the middle region of SRGN corresponding to a region with amino acids RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY |
| Other Names | PPG|PRG|PRG1|Prg|Prg1|Sgc|Pgsg |
| Gene, Accession # | Gene ID: 5552 |
| Catalog # | ABIN633597 |
| Price | |
| Order / More Info | serglycin (SRGN) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |