| Edit |   |
|---|
| Antigenic Specificity | 24-Dehydrocholesterol Reductase (DHCR24) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | DHCR24 is a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. The protein contains a leader sequence that directs it to the endoplasmic reticulum membrane. Missense mutations in this gene have been associated with desmosterolosis. Also, reduced expression of the gene occurs in the temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells. |
|---|
| Immunogen | DHCR24 antibody was raised using the N terminal of DHCR24 corresponding to a region with amino acids FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK |
|---|
| Other Names | MGC82737|zgc:101638|DCE|Nbla03646|SELADIN1|seladin-1|2310076D10Rik|5830417J06Rik|mKIAA0018 |
|---|
| Gene, Accession # | Gene ID: 1718,74754,298298 |
|---|
| Catalog # | ABIN634838 |
|---|
| Price | |
|---|
| Order / More Info | 24-Dehydrocholesterol Reductase (DHCR24) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|