| Edit |   |
| Antigenic Specificity | Annexin A10 (ANXA10) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | n/a |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The function of this gene has not yet been dete |
| Immunogen | Annexin A10 antibody was raised using the middle region of ANXA10 corresponding to a region with amino acids VLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINE |
| Other Names | ANXA10|ANX14|RGD1560956 |
| Gene, Accession # | n/a |
| Catalog # | ABIN634610 |
| Price | |
| Order / More Info | Annexin A10 (ANXA10) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |