| Edit |   |
|---|
| Antigenic Specificity | Annexin A4 (ANXA4) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | n/a |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 gene has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. |
|---|
| Immunogen | Annexin A4 antibody was raised using the middle region of ANXA4 corresponding to a region with amino acids EGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSL |
|---|
| Other Names | ANXA4|Anx4|XAnx4|pig28|X-anx4|Xanx-4|ANXIV|anx4|ANX4|PIG28|ZAP36|Annexin-4|P32.5|PAP-II|PP4-X|AI265406|AIV|AW106930 |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | ABIN634614 |
|---|
| Price | |
|---|
| Order / More Info | Annexin A4 (ANXA4) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|