| Edit |   |
| Antigenic Specificity | Annexin A3 (ANXA3) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | n/a |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ANXA3 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation. |
| Immunogen | Annexin A3 antibody was raised using the N terminal of ANXA3 corresponding to a region with amino acids MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN |
| Other Names | MGC80326|anxa3|zgc:101718|ANXA3|ANX3|Anx3|LC3|LRRGT00047 |
| Gene, Accession # | n/a |
| Catalog # | ABIN630250 |
| Price | |
| Order / More Info | Annexin A3 (ANXA3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |