| Edit |   |
| Antigenic Specificity | CK1 gamma 2 (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | CSNK1G2 belongs to the protein kinase superfamily, CK1 Ser/Thr protein kinase family, casein kinase I subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. It participates in Wnt signaling. |
| Immunogen | CK1 gamma 2 antibody was raised using the middle region of CSNK1 G2 corresponding to a region with amino acids SKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKR |
| Other Names | n/a |
| Gene, Accession # | n/a |
| Catalog # | ABIN632231 |
| Price | |
| Order / More Info | CK1 gamma 2 (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |