Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Anti-Hsp90 beta Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 beta (449-481aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences.Ig Type: Rabbit IgG
Other Names
heat shock protein HSP 90-beta isoform a; Heat shock protein HSP 90-beta; heat shock protein HSP 90-beta; heat shock protein 90kDa alpha family class B member 1; Heat shock 84 kDa; HSP 84; HSP84, HSP90AB1; HSP90AB1; HSP84; HSPC2; HSPCB; D6S182; HSP90B; HSP90B; HSPC2; HSPCB; HSP 90; HSP 84; HSP84
1. Entrez Gene: HSP90AB1 Heat shock protein 90kDa alpha (cytosolic), class B member 1. 2. Chen B, Piel WH, Gui L, Bruford E, Monteiro A (Dec 2005). The HSP90 family of genes in the human genome: insights into their divergence and evolution. Genomics 86 (6): 627-37. 3. Rebbe NF, Hickman WS, Ley TJ, Stafford DW, Hickman S (Sep 1989). Nucleotide sequence and regulation of a human 90-kDa heat shock protein gene. The Journal of Biological Chemistry 264 (25): 15006-11.