| Edit |   |
|---|
| Antigenic Specificity | RNA Binding Motif Protein, Y-Linked Family 1 Member A1 (RBMY1A1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RBMY1A1 is a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. The gene that encodes RBMY1A1 is Y-linked. RBMY1A1 may be involved in spermatogenesis. It is required for sperm development, possibly by participating in pre-mRNA splicing in the testis. |
|---|
| Immunogen | RBMY1 A1 antibody was raised using the N terminal of RBMY1 1 corresponding to a region with amino acids MSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRREN |
|---|
| Other Names | RBM|Rbm1|Rbm1-rs1|Rbmy1a1|Rbmy1a1-rs1|Rbmy1b|RBM1|RBM2|RBMY|RBMY1C|YRRM1|YRRM2 |
|---|
| Gene, Accession # | Gene ID: 5940 |
|---|
| Catalog # | ABIN633380 |
|---|
| Price | |
|---|
| Order / More Info | RNA Binding Motif Protein, Y-Linked Family 1 Member A1 (RBMY1A1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|