| Edit |   |
|---|
| Antigenic Specificity | Niemann Pick C2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | n/a |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry (IHC), Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Niemann Pick C2 Picoband Antibody. Reactivity: Human No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of human Niemann Pick C2 (KSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVS).Subcellular Localization: Secreted.Tissue Specificity: Epididymis. |
|---|
| Other Names | epididymal secretory protein E1; Epididymal secretory protein E1; epididymal secretory protein E1; NPC intracellular cholesterol transporter 2; Human epididymis-specific protein 1; He1; Niemann-Pick disease type C2 protein, NPC2; NPC2; HE1; EDDM1; HE1; He1 |
|---|
| Gene, Accession # | NPC2, Gene ID: 10577, NCBI: NP_006423.1, UniProt: P61916 |
|---|
| Catalog # | MBS1750673 |
|---|
| Price | |
|---|
| Order / More Info | Niemann Pick C2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|