| Edit |   |
|---|
| Antigenic Specificity | PSG5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | PSG5 antibody. Specificity: PSG5 antibody was raised against the middle region of PSG5 |
|---|
| Immunogen | PSG5 antibody was raised using the middle region of PSG5 corresponding to a region with amino acids SIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI |
|---|
| Other Names | PSG5; PSG5; PSG-5; PSG; FL-NCA-3; PSG 5; Pregnancy Specific Beta-1-Glycoprotein 5; PSG5, |
|---|
| Gene, Accession # | PSG5 |
|---|
| Catalog # | MBS839155 |
|---|
| Price | |
|---|
| Order / More Info | PSG5 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|