| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | LMO1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband? antibody for Rhombotin-1(LMO1) detection. Tested with WB in Human;Mouse;Rat. No cross reactivity with other proteins. Rhombotin-1 is a protein that in humans is encoded by the LMO1 gene. This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding domain. LIM domains may play a role in protein interactions; thus the encoded protein may regulate transcription by competitively binding to specific DNA-binding transcription factors. Alterations at this locus have been associated with acute lymphoblastic T-cell leukemia. Chromosomal rearrangements have been observed between this locus and at least two loci, the delta subunit of the T-cell antigen receptor gene and the LIM domain binding 1 gene. Alternatively spliced transcript variants have been described. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human LMO1 (127-156aa DKFFLKNNMILCQMDYEEGQLNGTFESQVQ), different from the related mouse sequence by two amino acids. |
| Other Names | Rhombotin-1;Cysteine-rich protein TTG-1;LIM domain only protein 1;LMO-1;T-cell translocation protein 1;LMO1;RBTN1, RHOM1, TTG1; |
| Gene, Accession # | LMO1, UniProt: P25800 |
| Catalog # | A06093-1 |
| Price | |
| Order / More Info | LMO1 Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|