| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | LMO2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 100ug |
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband? antibody for LMO2 detection. Tested with WB in Human;Mouse;Rat. No cross reactivity with other proteins. LIM domain only 2 (rhombotin-like 1), also known as LMO2, RBTNL1, RBTN2, RHOM2, LIM Domain Only Protein 2, TTG2, and T-Cell Translocation Protein 2, is a protein which in humans is encoded by the LMO2 gene. LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Immunogen | A synthetic peptide corresponding to a sequence of human LMO2 (QKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI). |
| Other Names | Rhombotin-2; Cysteine-rich protein TTG-2; LIM domain only protein 2; LMO-2; T-cell translocation protein 2; LMO2; RBTN2; RBTNL1; RHOM2; TTG2 |
| Gene, Accession # | LMO2, UniProt: P25791 |
| Catalog # | A03502-1 |
| Price | |
| Order / More Info | LMO2 Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|