Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The ABCA13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABCA13. This antibody reacts with human. The ABCA13 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ABCA13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DWLPLNQTFSQVSELVLNVTISTLTFLQQHGVAVTEPVYHLSMQNIVWDPQKVQYDLKSQFGFDDLHTEQILNSSAELKEIPTDTSLEKMVCSV
Other Names
ATP binding cassette transporter A13, ATP-binding cassette sub-family A member 13, ATP-binding cassette, sub-family A (ABC1), member 13, DKFZp313D2411, EC 2.7.11.25, EC 3.6.3, FLJ16398, FLJ33876, FLJ33951