Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The ABCA6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABCA6. This antibody reacts with human. The ABCA6 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ABCA6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LYFDKILPYGDERHYSPLFFLNSSSCFQHQRTNAKVIEKEIDAEHPSDDYF
Other Names
ABC transporter ABCA6, ATP-binding cassette A6, ATP-binding cassette sub-family A member 6, ATP-binding cassette, sub-family A (ABC1), member 6, EC 2.5.1.19, EC 3.6.3, EC 3.6.3.25, EST155051, FLJ43498